PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12962.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 297aa    MW: 32699.1 Da    PI: 10.0792
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12962.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.34.7e-20550147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+++G+++W++I++ ++ gR++k+c++rw + 
       KHN12962.1  5 KGPWSPEEDEALQKLVEKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 50
                     79******************************.***********985 PP

2Myb_DNA-binding52.88.9e-1759101347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar +  gRt++ +k++w++ 
       KHN12962.1  59 AFTAEEDDTIIRAHARFGNK-WATIARLLH-GRTDNAIKNHWNST 101
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129430.219155IPR017930Myb domain
SuperFamilySSF466891.91E-32298IPR009057Homeodomain-like
SMARTSM007174.3E-18453IPR001005SANT/Myb domain
PfamPF002491.4E-19550IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-26658IPR009057Homeodomain-like
CDDcd001671.64E-17749No hitNo description
SMARTSM007179.1E-1456104IPR001005SANT/Myb domain
PROSITE profilePS5129419.98957106IPR017930Myb domain
PfamPF002492.4E-1459101IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2359105IPR009057Homeodomain-like
CDDcd001673.27E-1159102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MDRIKGPWSP EEDEALQKLV EKHGPRNWSL ISKSIPGRSG KSCRLRWCNQ LSPQVEHRAF  60
TAEEDDTIIR AHARFGNKWA TIARLLHGRT DNAIKNHWNS TLKRKCSSTM IDDNTQPLKR  120
SVSAGAAIPV STGLYMNPPT PGSPSGSDVS ESSLPVASSS HVFRPVPRTV KVLPPVETTS  180
SSNDPPTSLS LSLPGVGVVD SSEVSNRTTE PIHFTPPMPH RSNTMPLLPM MTSVSATVMA  240
PFNFSAEFRS VMQEMIRKEV RSYIELHNQN GMCFQAAVND GFRNASVKRI GISRVDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-4141053104MYB PROTO-ONCOGENE PROTEIN
1h88_C2e-40410557158MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-40410557158MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-4141063105C-Myb DNA-Binding Domain
1msf_C3e-4141063105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312620.0KT031262.1 Glycine max clone HN_CCL_49 MYB/HD-like transcription factor (Glyma11g05550.1_like1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001238087.10.0MYB transcription factor MYB50
SwissprotQ9FDW17e-97MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0B2PZH60.0A0A0B2PZH6_GLYSO; Transcription factor MYB44
TrEMBLQ0PJL90.0Q0PJL9_SOYBN; MYB transcription factor MYB50
STRINGGLYMA11G05550.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-91myb domain protein 73
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]